Recombinant Human DDB1 protein, His-tagged
| Cat.No. : | DDB1-11877H |
| Product Overview : | Recombinant Human DDB1 protein(1-400 aa), fused with His tag, was expressed in E.coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-400 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DDB1 damage-specific DNA binding protein 1, 127kDa [ Homo sapiens ] |
| Official Symbol | DDB1 |
| Synonyms | DDB1; damage-specific DNA binding protein 1, 127kDa; damage specific DNA binding protein 1 (127kD); DNA damage-binding protein 1; XPE; XAP-1; UV-DDB 1; DDB p127 subunit; XPE-binding factor; HBV X-associated protein 1; DNA damage-binding protein a; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; damage-specific DNA-binding protein 1; xeroderma pigmentosum group E-complementing protein; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1; |
| Gene ID | 1642 |
| mRNA Refseq | NM_001923 |
| Protein Refseq | NP_001914 |
| MIM | 600045 |
| UniProt ID | Q16531 |
| ◆ Recombinant Proteins | ||
| DDB1-3982H | Recombinant Human DDB1 Protein | +Inquiry |
| DDB1-28308TH | Recombinant Human DDB1 protein, GST-tagged | +Inquiry |
| DDB1-2251M | Recombinant Mouse DDB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDB1-4381M | Recombinant Mouse DDB1 Protein | +Inquiry |
| DDB1-33HFL | Recombinant Full Length Human damage specific DNA binding protein 1 Protein, GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDB1 Products
Required fields are marked with *
My Review for All DDB1 Products
Required fields are marked with *
