Recombinant Human DDX19B protein, His-SUMO-tagged
| Cat.No. : | DDX19B-8544H |
| Product Overview : | Recombinant Human DDX19B protein(Q9UMR2)(2-479aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-479a.a. |
| Tag : | His&SUMO |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 66.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN |
| Gene Name | DDX19B DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B [ Homo sapiens ] |
| Official Symbol | DDX19B |
| Synonyms | DDX19B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B; DDX19, DEAD (Asp Glu Ala As) box polypeptide 19 , DEAD/H (Asp Glu Ala Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); ATP-dependent RNA helicase DDX19B; DBP5; DEAD-box protein 5; yeast Dbp5 homolog; DEAD box protein 19B; DEAD box RNA helicase DEAD5; DEAD-box RNA helicase DEAD5; ATP-dependent RNA helicase DDX19; DEAD (Asp-Glu-Ala-As) box polypeptide 19B; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); RNAh; DDX19; |
| Gene ID | 11269 |
| mRNA Refseq | NM_001014449 |
| Protein Refseq | NP_001014449 |
| MIM | 605812 |
| UniProt ID | Q9UMR2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX19B Products
Required fields are marked with *
My Review for All DDX19B Products
Required fields are marked with *



