Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DDX24, His-tagged

Cat.No. : DDX24-28324TH
Product Overview : Recombinant fragment, corresponding to amino acids 674-859 of Human DDX24 with N terminal His tag; 186 amino acids, 35kDa.
  • Specification
  • Gene Information
  • Related Products
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which shows little similarity to any of the other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 at the amino acid level.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 115 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIP LFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSW IEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKE LRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESA LSCLSKQKKKKTKKPKEPQPEQPQPSTSAN
Gene Name : DDX24 DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [ Homo sapiens ]
Official Symbol : DDX24
Synonyms : DDX24; DEAD (Asp-Glu-Ala-Asp) box polypeptide 24; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 24; ATP-dependent RNA helicase DDX24;
Gene ID : 57062
mRNA Refseq : NM_020414
Protein Refseq : NP_065147
MIM : 606181
Uniprot ID : Q9GZR7
Chromosome Location : 14q32
Function : ATP binding; ATP-dependent RNA helicase activity; ATP-dependent helicase activity; RNA binding; RNA helicase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends