Recombinant Human DDX24 protein, GST-tagged
Cat.No. : | DDX24-11898H |
Product Overview : | Recombinant Human DDX24(509-859aa) protein was fused to GST-tag and expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 351 |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which shows little similarity to any of the other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 at the amino acid level. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
Molecular Mass : | 64 kDa |
AA Sequence : | TLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPEQPQPSTSAN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | DDX24 |
Official Symbol | DDX24 |
Gene ID | 57062 |
mRNA Refseq | NM_020414.4 |
Protein Refseq | NP_065147.1 |
MIM | 606181 |
UniProt ID | Q9GZR7 |
◆ Recombinant Proteins | ||
DDX24-11897H | Recombinant Human DDX24 protein, His-tagged | +Inquiry |
DDX24-28324TH | Recombinant Human DDX24, His-tagged | +Inquiry |
DDX24-11898H | Recombinant Human DDX24 protein, GST-tagged | +Inquiry |
DDX24-2563HF | Recombinant Full Length Human DDX24 Protein, GST-tagged | +Inquiry |
DDX24-2476H | Recombinant Human DDX24 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX24-7013HCL | Recombinant Human DDX24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX24 Products
Required fields are marked with *
My Review for All DDX24 Products
Required fields are marked with *