Recombinant Human DDX39B protein, GST-tagged
Cat.No. : | DDX39B-082H |
Product Overview : | Human DDX39B full-length ORF ( AAH00361, 1 a.a. - 428 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 72.82 kDa |
AA Sequence : | MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX39B DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B [ Homo sapiens ] |
Official Symbol | DDX39B |
Synonyms | DDX39B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; BAT1, HLA B associated transcript 1; spliceosome RNA helicase DDX39B; D6S81E; U2AF65 associated protein 56; UAP56; spliceosome RNA helicase BAT1; ATP-dependent RNA helicase p47; 56 kDa U2AF65-associated protein; nuclear RNA helicase (DEAD family); HLA-B-associated transcript 1 protein; BAT1; |
Gene ID | 7919 |
mRNA Refseq | NM_004640 |
Protein Refseq | NP_004631 |
MIM | 142560 |
UniProt ID | Q13838 |
◆ Recombinant Proteins | ||
DDX39B-1820R | Recombinant Rat DDX39B Protein | +Inquiry |
Ddx39b-2505M | Recombinant Mouse Ddx39b Protein, Myc/DDK-tagged | +Inquiry |
DDX39B-4414M | Recombinant Mouse DDX39B Protein | +Inquiry |
DDX39B-12225Z | Recombinant Zebrafish DDX39B | +Inquiry |
DDX39B-1216R | Recombinant Rhesus monkey DDX39B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX39B-8512HCL | Recombinant Human BAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX39B Products
Required fields are marked with *
My Review for All DDX39B Products
Required fields are marked with *
0
Inquiry Basket