Recombinant Human DDX39B protein, GST-tagged

Cat.No. : DDX39B-082H
Product Overview : Human DDX39B full-length ORF ( AAH00361, 1 a.a. - 428 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 72.82 kDa
AA Sequence : MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DDX39B DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B [ Homo sapiens ]
Official Symbol DDX39B
Synonyms DDX39B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; BAT1, HLA B associated transcript 1; spliceosome RNA helicase DDX39B; D6S81E; U2AF65 associated protein 56; UAP56; spliceosome RNA helicase BAT1; ATP-dependent RNA helicase p47; 56 kDa U2AF65-associated protein; nuclear RNA helicase (DEAD family); HLA-B-associated transcript 1 protein; BAT1;
Gene ID 7919
mRNA Refseq NM_004640
Protein Refseq NP_004631
MIM 142560
UniProt ID Q13838

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX39B Products

Required fields are marked with *

My Review for All DDX39B Products

Required fields are marked with *

0
cart-icon