Recombinant Human DDX4 Protein, His-tagged
| Cat.No. : | DDX4-001H |
| Product Overview : | DDX4-001H Recombinant Human DDX4 Protein, C-His-tagged,expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-145 aa |
| Tag : | C-His |
| Molecular Mass : | 17 kDa |
| AA Sequence : | MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSEASGPYHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4, 10% Glycerol, 5% Trehalose |
| Gene Name | DDX4 DEAD-box helicase 4 [ Homo sapiens (human) ] |
| Official Symbol | DDX4 |
| Synonyms | DDX4,DEAD (Asp-Glu-Ala-Asp) box polypeptide 4,DEAD/H (Asp Glu Ala Asp/His) box polypeptide 4,probable ATP-dependent RNA helicase DDX4,VASA,vasa homolog,DEAD box protein 4,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4, MGC111074 |
| Gene ID | 54514 |
| MIM | 605281 |
| UniProt ID | Q9NQI0 |
| ◆ Recombinant Proteins | ||
| DDX4-1479R | Recombinant Rat DDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDX4-1043R | Recombinant Rhesus Macaque DDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ddx4-2507M | Recombinant Mouse Ddx4 Protein, Myc/DDK-tagged | +Inquiry |
| DDX4-457C | Recombinant Cynomolgus DDX4 Protein, His-tagged | +Inquiry |
| DDX4-2588HF | Recombinant Full Length Human DDX4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX4-7006HCL | Recombinant Human DDX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX4 Products
Required fields are marked with *
My Review for All DDX4 Products
Required fields are marked with *
