Recombinant Human DDX4 Protein, His-tagged
Cat.No. : | DDX4-001H |
Product Overview : | DDX4-001H Recombinant Human DDX4 Protein, C-His-tagged,expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-145 aa |
Tag : | C-His |
Molecular Mass : | 17 kDa |
AA Sequence : | MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSEASGPYHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH 7.4, 10% Glycerol, 5% Trehalose |
Gene Name | DDX4 DEAD-box helicase 4 [ Homo sapiens (human) ] |
Official Symbol | DDX4 |
Synonyms | DDX4,DEAD (Asp-Glu-Ala-Asp) box polypeptide 4,DEAD/H (Asp Glu Ala Asp/His) box polypeptide 4,probable ATP-dependent RNA helicase DDX4,VASA,vasa homolog,DEAD box protein 4,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 4, MGC111074 |
Gene ID | 54514 |
MIM | 605281 |
UniProt ID | Q9NQI0 |
◆ Recombinant Proteins | ||
DDX4-1479R | Recombinant Rat DDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX4-468H | Recombinant Human DDX4 Protein, MYC/DDK-tagged | +Inquiry |
DDX4-2145H | Recombinant Human DDX4 Protein (Asn35-Gly131), N-His tagged | +Inquiry |
DDX4-1043R | Recombinant Rhesus Macaque DDX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX4-2012H | Recombinant Human DDX4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX4-7006HCL | Recombinant Human DDX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX4 Products
Required fields are marked with *
My Review for All DDX4 Products
Required fields are marked with *