Recombinant Human DDX50 protein, GST-tagged
| Cat.No. : | DDX50-30159H |
| Product Overview : | Recombinant Human DDX50 (136-381 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu136-VAL381 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | EGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | DDX50 DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 [ Homo sapiens ] |
| Official Symbol | DDX50 |
| Synonyms | DDX50; DEAD (Asp-Glu-Ala-Asp) box polypeptide 50; ATP-dependent RNA helicase DDX50; GU2; GUB; MGC3199; RH II/GuB; gu-beta; DEAD box protein 50; nucleolar protein GU2; RNA helicase II/Gu beta; RH-II/GuB; |
| Gene ID | 79009 |
| mRNA Refseq | NM_024045 |
| Protein Refseq | NP_076950 |
| MIM | 610373 |
| UniProt ID | Q9BQ39 |
| ◆ Recombinant Proteins | ||
| DDX50-2310H | Recombinant Human DDX50 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DDX50-1047R | Recombinant Rhesus Macaque DDX50 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DDX50-2647HF | Recombinant Full Length Human DDX50 Protein, GST-tagged | +Inquiry |
| DDX50-4425M | Recombinant Mouse DDX50 Protein | +Inquiry |
| DDX50-2276M | Recombinant Mouse DDX50 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX50-7003HCL | Recombinant Human DDX50 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX50 Products
Required fields are marked with *
My Review for All DDX50 Products
Required fields are marked with *
