Recombinant Human DDX56 protein, GST-tagged

Cat.No. : DDX56-276H
Product Overview : Recombinant Human DDX56(1 a.a. - 783 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-783 a.a.
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to beinvolved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an antigen recognized by autoimmune antibodies from a patient with watermelon stomach disease. This protein unwinds double-strandedRNA, folds single-stranded RNA, and may play important roles in ribosomal RNA biogenesis, RNA editing, RNA transport, and general transcription.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 113.7 kDa
AA Sequence : MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSK KAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKL KNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKD LIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGG QFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFS ATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKE AQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRS GRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEK LIEEKGAVEALAAALAHISGATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFL KGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREG SRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DDX56 DEAD (Asp-Glu-Ala-Asp) box helicase 56 [ Homo sapiens ]
Official Symbol DDX56
Synonyms DDX56; DEAD (Asp-Glu-Ala-Asp) box helicase 56; DEAD (Asp Glu Ala Asp) box polypeptide 56; probable ATP-dependent RNA helicase DDX56; NOH61; nucleolar helicase of 61 kDa; DEAD box protein 21; DEAD box protein 56; DEAD-box RNA helicase; 61-kd nucleolar helicase; putative nucleolar RNA helicase; DEAD (Asp-Glu-Ala-Asp) box polypeptide 56; ATP-dependent 61 kDa nucleolar RNA helicase; DDX21; DDX26;
Gene ID 54606
mRNA Refseq NM_001257189
Protein Refseq NP_001244118
MIM 608023
UniProt ID Q9NY93
Chromosome Location 7p13
Function ATP binding; ATP-dependent RNA helicase activity; RNA binding; helicase activity; hydrolase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX56 Products

Required fields are marked with *

My Review for All DDX56 Products

Required fields are marked with *

0
cart-icon
0
compare icon