Recombinant Human DEAF1 protein, His-tagged
| Cat.No. : | DEAF1-11919H |
| Product Overview : | Recombinant Human DEAF1 protein(1-316 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 02, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-316 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAGGEAEEPVLSRDEDSEEDADSEAERETPRVTAVAVMAAEPGHMDMGAEALPGPDEAAAAAAFAEVTTVTVANVGAAADNVFTTSVANAASISGHVLSGRTALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTEFEAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDDMTLSGPVRLFVPYKRRKKENELPTTPVKK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DEAF1 deformed epidermal autoregulatory factor 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DEAF1 |
| Synonyms | DEAF1; deformed epidermal autoregulatory factor 1 (Drosophila); deformed epidermal autoregulatory factor 1 homolog; NUDR; SPN; ZMYND5; suppressin; zinc finger MYND domain-containing protein 5; nuclear DEAF-1-related transcriptional regulator; |
| Gene ID | 10522 |
| mRNA Refseq | NM_021008 |
| Protein Refseq | NP_066288 |
| MIM | 602635 |
| UniProt ID | O75398 |
| ◆ Recombinant Proteins | ||
| DEAF1-4435M | Recombinant Mouse DEAF1 Protein | +Inquiry |
| DEAF1-2281M | Recombinant Mouse DEAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEAF1-1825R | Recombinant Rat DEAF1 Protein | +Inquiry |
| DEAF1-1483R | Recombinant Rat DEAF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEAF1-11919H | Recombinant Human DEAF1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEAF1-461HCL | Recombinant Human DEAF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEAF1 Products
Required fields are marked with *
My Review for All DEAF1 Products
Required fields are marked with *
