Recombinant Human DEFA1, GST-tagged
Cat.No. : | DEFA1-2155H |
Product Overview : | RecombinantHuman protein DEFA1 with GST-tag at N-terminal was produced in wheat germ expressionsystem in vitro and purified by GlutathioneSepharose 4 Fast Flow, 36.08 KDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Defensins are a family of microbicidal and cytotoxic peptidesthought to be involved in host defense. They are abundant in the granules ofneutrophils and also found in the epithelia of mucosal surfaces such as thoseof the intestine, respiratory tract, urinary tract, and vagina. Members of thedefensin family are highly similar in protein sequence and distinguished by aconserved cysteine motif. The protein encoded by this gene, defensin, alpha1, is found in the microbicidal granules of neutrophils and likely plays arole in phagocyte-mediated host defense. Several alpha defensin genes areclustered on chromosome 8. This gene differs from defensin, alpha 3 by onlyone amino acid. This gene and the gene encoding defensin, alpha 3 are bothsubject to copy number variation. |
AminoAcid Sequence : | MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
Note : | Best usewithin three months from the date of receipt of this protein. |
Applications : | ELISA;WB; Antibody Production; Protein Array |
Storage Buffer : | 50 mMTris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer. |
Storage : | Storeat -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Name | DEFA1 defensin, alpha 1 [ Homo sapiens ] |
Official Symbol | DEFA1 |
Synonyms | DEFA1;defensin, alpha 1; HP1; MRS; DEF1; HP-1; DEFA2; HNP-1; DEFA1B; MGC138393; neutrophildefensin 1; defensin, alpha 2; myeloid-related sequence; defensin, alpha 1,myeloid-related sequence; OTTHUMP00000196017 |
Gene ID | 1667 |
mRNA Refseq | NM_004084 |
Protein Refseq | NP_004075 |
MIM | 125220 |
UniProt ID | P59665 |
Chromosome Location | 8p23.1 |
Pathway | Alpha-defensins;Cellular roles of Anthrax toxin; Defensins; Immune System; Innate ImmuneSystem |
◆ Recombinant Proteins | ||
DEFA1-454H | Recombinant Human DEFA1 Protein, MYC/DDK-tagged | +Inquiry |
DEFA1-955H | Recombinant Human Defensin, Alpha 1 | +Inquiry |
DEFA1-0542H | Recombinant Human DEFA1 protein, Twin-Strep-tagged | +Inquiry |
DEFA1-26678TH | Recombinant Human DEFA1 | +Inquiry |
DEFA1-1939H | Recombinant Human DEFA1 Protein (Glu20-Cys94), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA1-6991HCL | Recombinant Human DEFA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFA1 Products
Required fields are marked with *
My Review for All DEFA1 Products
Required fields are marked with *
0
Inquiry Basket