Recombinant Human DEFA1 protein, GST-tagged
| Cat.No. : | DEFA1-2811H |
| Product Overview : | Recombinant Human DEFA1 protein(P59665)(1-94aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-94aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.2 kDa |
| AA Sequence : | DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DEFA1 defensin, alpha 1 [ Homo sapiens ] |
| Official Symbol | DEFA1 |
| Synonyms | DEFA1; defensin, alpha 1; DEF1, DEFA2, defensin, alpha 1, myeloid related sequence , defensin, alpha 2 , MRS; neutrophil defensin 1; HNP 1; defensin, alpha 2; myeloid-related sequence; defensin, alpha 1, myeloid-related sequence; HP1; MRS; DEF1; HP-1; DEFA2; HNP-1; DEFA1B; MGC138393; |
| Gene ID | 1667 |
| mRNA Refseq | NM_004084 |
| Protein Refseq | NP_004075 |
| MIM | 125220 |
| UniProt ID | P59665 |
| ◆ Recombinant Proteins | ||
| DEFA1-0542H | Recombinant Human DEFA1 protein, Twin-Strep-tagged | +Inquiry |
| DEFA1-4893H | Recombinant Human DEFA1 protein, His-tagged | +Inquiry |
| DEFA1-6903HF | Recombinant Full Length Human DEFA1 Protein, GST-tagged | +Inquiry |
| DEFA1-1930H | Recombinant Human DEFA1 protein, Strep-tagged | +Inquiry |
| DEFA1-2194M | Recombinant Mouse DEFA1 Protein (59-93 aa), GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEFA1-6991HCL | Recombinant Human DEFA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA1 Products
Required fields are marked with *
My Review for All DEFA1 Products
Required fields are marked with *
