Recombinant Human DEFA1 protein, GST-tagged

Cat.No. : DEFA1-2811H
Product Overview : Recombinant Human DEFA1 protein(P59665)(1-94aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-94aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.2 kDa
AA Sequence : DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name DEFA1 defensin, alpha 1 [ Homo sapiens ]
Official Symbol DEFA1
Synonyms DEFA1; defensin, alpha 1; DEF1, DEFA2, defensin, alpha 1, myeloid related sequence , defensin, alpha 2 , MRS; neutrophil defensin 1; HNP 1; defensin, alpha 2; myeloid-related sequence; defensin, alpha 1, myeloid-related sequence; HP1; MRS; DEF1; HP-1; DEFA2; HNP-1; DEFA1B; MGC138393;
Gene ID 1667
mRNA Refseq NM_004084
Protein Refseq NP_004075
MIM 125220
UniProt ID P59665

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFA1 Products

Required fields are marked with *

My Review for All DEFA1 Products

Required fields are marked with *

0
cart-icon