Recombinant Human DEFA1 protein, GST-tagged
Cat.No. : | DEFA1-2811H |
Product Overview : | Recombinant Human DEFA1 protein(P59665)(1-94aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-94aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DEFA1 defensin, alpha 1 [ Homo sapiens ] |
Official Symbol | DEFA1 |
Synonyms | DEFA1; defensin, alpha 1; DEF1, DEFA2, defensin, alpha 1, myeloid related sequence , defensin, alpha 2 , MRS; neutrophil defensin 1; HNP 1; defensin, alpha 2; myeloid-related sequence; defensin, alpha 1, myeloid-related sequence; HP1; MRS; DEF1; HP-1; DEFA2; HNP-1; DEFA1B; MGC138393; |
Gene ID | 1667 |
mRNA Refseq | NM_004084 |
Protein Refseq | NP_004075 |
MIM | 125220 |
UniProt ID | P59665 |
◆ Recombinant Proteins | ||
DEFA1-2811H | Recombinant Human DEFA1 protein, GST-tagged | +Inquiry |
Defa1-2812M | Recombinant Mouse Defa1 protein, His-GST-tagged | +Inquiry |
DEFA1-2155H | Recombinant Human DEFA1, GST-tagged | +Inquiry |
DEFA1-1930H | Recombinant Human DEFA1 protein, Strep-tagged | +Inquiry |
DefA1-3830D | Recombinant Duckbill platypus DefA1 protein, His-KSI-tagged | +Inquiry |
◆ Native Proteins | ||
DEFA1-26186TH | Recombinant Human DEFA1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA1-6991HCL | Recombinant Human DEFA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA1 Products
Required fields are marked with *
My Review for All DEFA1 Products
Required fields are marked with *