Recombinant Human DEFA3 Protein (39-94 aa), His-tagged
| Cat.No. : | DEFA3-2596H |
| Product Overview : | Recombinant Human DEFA3 Protein (39-94 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 39-94 aa |
| Description : | Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 8.4 kDa |
| AA Sequence : | DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ] |
| Official Symbol | DEFA3 |
| Synonyms | DEFA3; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; HP3; HNP3; HP-3; HNP-3; |
| Gene ID | 1668 |
| mRNA Refseq | NM_005217 |
| Protein Refseq | NP_005208 |
| MIM | 604522 |
| UniProt ID | P59666 |
| ◆ Recombinant Proteins | ||
| DEFA3-1141H | Recombinant Human DEFA3 protein, His-tagged | +Inquiry |
| DEFA3-4454M | Recombinant Mouse DEFA3 Protein | +Inquiry |
| DEFA3-2518H | Recombinant Human DEFA3 Protein, GST-tagged | +Inquiry |
| DEFA3-2293M | Recombinant Mouse DEFA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEFA3-2813H | Recombinant Human DEFA3 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEFA3-221HCL | Recombinant Human DEFA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA3 Products
Required fields are marked with *
My Review for All DEFA3 Products
Required fields are marked with *
