Recombinant Human DEFA3 Protein (39-94 aa), His-tagged
Cat.No. : | DEFA3-2596H |
Product Overview : | Recombinant Human DEFA3 Protein (39-94 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 39-94 aa |
Description : | Defensin 2 and defensin 3 have antibiotic, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 8.4 kDa |
AA Sequence : | DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ] |
Official Symbol | DEFA3 |
Synonyms | DEFA3; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; HP3; HNP3; HP-3; HNP-3; |
Gene ID | 1668 |
mRNA Refseq | NM_005217 |
Protein Refseq | NP_005208 |
MIM | 604522 |
UniProt ID | P59666 |
◆ Recombinant Proteins | ||
DEFA3-1141H | Recombinant Human DEFA3 protein, His-tagged | +Inquiry |
DEFA3-4454M | Recombinant Mouse DEFA3 Protein | +Inquiry |
DEFA3-2518H | Recombinant Human DEFA3 Protein, GST-tagged | +Inquiry |
DEFA3-2293M | Recombinant Mouse DEFA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFA3-2813H | Recombinant Human DEFA3 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA3-221HCL | Recombinant Human DEFA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA3 Products
Required fields are marked with *
My Review for All DEFA3 Products
Required fields are marked with *