Recombinant Human DEFA3 protein, His-SUMO-tagged
Cat.No. : | DEFA3-2813H |
Product Overview : | Recombinant Human DEFA3 protein(P59666)(39-94aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 39-94aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.4 kDa |
AA Sequence : | DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ] |
Official Symbol | DEFA3 |
Synonyms | DEFA3; defensin, alpha 3, neutrophil-specific; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; defensin 3, neutrophil-specific; HP3; HNP3; HP-3; HNP-3; |
Gene ID | 1668 |
mRNA Refseq | NM_005217 |
Protein Refseq | NP_005208 |
MIM | 604522 |
UniProt ID | P59666 |
◆ Recombinant Proteins | ||
DEFA3-647H | Recombinant Human DEFA3 Protein, Fc-tagged | +Inquiry |
DEFA3-2596H | Recombinant Human DEFA3 Protein (39-94 aa), His-tagged | +Inquiry |
DEFA3-701H | Recombinant Human DEFA3 | +Inquiry |
DEFA3-1141H | Recombinant Human DEFA3 protein, His-tagged | +Inquiry |
DEFA3-2518H | Recombinant Human DEFA3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFA3-221HCL | Recombinant Human DEFA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA3 Products
Required fields are marked with *
My Review for All DEFA3 Products
Required fields are marked with *