Recombinant Human DEFA3 protein, His-SUMO-tagged
| Cat.No. : | DEFA3-2813H |
| Product Overview : | Recombinant Human DEFA3 protein(P59666)(39-94aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 39-94aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.4 kDa |
| AA Sequence : | DIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DEFA3 defensin, alpha 3, neutrophil-specific [ Homo sapiens ] |
| Official Symbol | DEFA3 |
| Synonyms | DEFA3; defensin, alpha 3, neutrophil-specific; DEF3; neutrophil defensin 3; HNP 3; neutrophil peptide 3; defensin 3, neutrophil-specific; HP3; HNP3; HP-3; HNP-3; |
| Gene ID | 1668 |
| mRNA Refseq | NM_005217 |
| Protein Refseq | NP_005208 |
| MIM | 604522 |
| UniProt ID | P59666 |
| ◆ Recombinant Proteins | ||
| DEFA3-2425HF | Recombinant Full Length Human DEFA3 Protein, GST-tagged | +Inquiry |
| DEFA3-2785H | Recombinant Human DEFA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEFA3-1941H | Recombinant Human DEFA3 Protein (Pro21-Cys94), N-GST tagged | +Inquiry |
| DEFA3-2518H | Recombinant Human DEFA3 Protein, GST-tagged | +Inquiry |
| DEFA3-1141H | Recombinant Human DEFA3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEFA3-221HCL | Recombinant Human DEFA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFA3 Products
Required fields are marked with *
My Review for All DEFA3 Products
Required fields are marked with *
