Recombinant Human DEFB103A protein, GST-tagged
Cat.No. : | DEFB103A-301628H |
Product Overview : | Recombinant Human DEFB103A (23-67 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met23-Lys67 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DEFB103A defensin, beta 103A [ Homo sapiens ] |
Official Symbol | DEFB103A |
Synonyms | DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103; |
Gene ID | 414325 |
mRNA Refseq | NM_001081551 |
Protein Refseq | NP_001075020 |
UniProt ID | P81534 |
◆ Recombinant Proteins | ||
DEFB103A-301628H | Recombinant Human DEFB103A protein, GST-tagged | +Inquiry |
DEFB103A-7304H | Recombinant Human DEFB103A protein, His-tagged | +Inquiry |
DEFB103A-2431HF | Recombinant Full Length Human DEFB103A Protein, GST-tagged | +Inquiry |
DEFB103A-2522H | Recombinant Human DEFB103A Protein, GST-tagged | +Inquiry |
DEFB103A-69H | Recombinant Human DEFB103A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB103A-464HCL | Recombinant Human DEFB103A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB103A Products
Required fields are marked with *
My Review for All DEFB103A Products
Required fields are marked with *
0
Inquiry Basket