Recombinant Human DEFB103A protein, GST-tagged

Cat.No. : DEFB103A-301628H
Product Overview : Recombinant Human DEFB103A (23-67 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met23-Lys67
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name DEFB103A defensin, beta 103A [ Homo sapiens ]
Official Symbol DEFB103A
Synonyms DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103;
Gene ID 414325
mRNA Refseq NM_001081551
Protein Refseq NP_001075020
UniProt ID P81534

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB103A Products

Required fields are marked with *

My Review for All DEFB103A Products

Required fields are marked with *

0
cart-icon
0
compare icon