Recombinant Human DEFB103A protein, GST-tagged
Cat.No. : | DEFB103A-301628H |
Product Overview : | Recombinant Human DEFB103A (23-67 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Met23-Lys67 |
AA Sequence : | MGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | DEFB103A defensin, beta 103A [ Homo sapiens ] |
Official Symbol : | DEFB103A |
Synonyms : | DEFB103A; defensin, beta 103A; DEFB3, DEFB103, defensin, beta 3; beta-defensin 103; DEFB 3; HBD 3; HBD3; HBP 3; HBP3; beta-defensin 3; defensin, beta 3; defensin, beta 103; defensin-like protein; BD-3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103; |
Gene ID : | 414325 |
mRNA Refseq : | NM_001081551 |
Protein Refseq : | NP_001075020 |
UniProt ID : | P81534 |
Products Types
◆ Recombinant Protein | ||
DEFB103A-69H | Recombinant Human DEFB103A Protein | +Inquiry |
DEFB103A-2522H | Recombinant Human DEFB103A Protein, GST-tagged | +Inquiry |
DEFB103A-84H | Recombinant Human DEFB103A protein | +Inquiry |
DEFB103A-85H | Recombinant Human DEFB103A protein, His-tagged | +Inquiry |
DEFB103A-7304H | Recombinant Human DEFB103A protein, His-tagged | +Inquiry |
◆ Lysates | ||
DEFB103A-464HCL | Recombinant Human DEFB103A cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionDEFB103A deficiency has been linked to an increased susceptibility to various infections, particularly those affecting the skin and mucosal surfaces.
While research is ongoing, potential side effects and concerns related to the therapeutic use of DEFB103A or its analogs need to be thoroughly investigated, including any possible immunogenicity.
DEFB103A plays a role in maintaining a balanced microbiome by exerting selective antimicrobial activity. Understanding this interaction is crucial for potential applications in microbiome-related disorders.
DEFB103A is implicated in modulating inflammation. It can influence the immune response and may have a role in inflammatory conditions such as psoriasis and inflammatory bowel disease.
DEFB103A plays a crucial role in the innate immune system by acting as an antimicrobial peptide. It helps defend the body against a wide range of pathogens, including bacteria, viruses, and fungi.
Customer Reviews (3)
Write a reviewThis unique capability to selectively bind to exposed PS simplifies the identification and quantification of different cellular populations, reducing experimental errors and enhancing accuracy.
They can provide technical assistance, ensuring optimal utilization of the product.
This may include providing detailed protocols, troubleshooting guidance, and access to knowledgeable experts who can answer any inquiries or concerns.
Ask a Question for All DEFB103A Products
Required fields are marked with *
My Review for All DEFB103A Products
Required fields are marked with *
Inquiry Basket