Recombinant Human DEFB106A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DEFB106A-3898H
Product Overview : DEFB106A MS Standard C13 and N15-labeled recombinant protein (NP_689464) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. Chromosome 8p23 contains at least two copies of the duplicated beta-defensin cluster. This duplication results in two identical copies of defensin, beta 106, DEFB106A and DEFB106B, in head-to-head orientation. This gene, DEFB106A, represents the more centromeric copy.
Molecular Mass : 7.4 kDa
AA Sequence : MRTFLFLFAVLFFLTPAKNAFFDEKCNKLKGTCKNNCGKNEELIALCQKSLKCCRTIQPCGSIIDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DEFB106A defensin beta 106A [ Homo sapiens (human) ]
Official Symbol DEFB106A
Synonyms DEFB106A; defensin, beta 106A; DEFB106, defensin, beta 106; beta-defensin 106; DEFB 6; beta-defensin 6; defensin, beta 6; BD-6; DEFB-6; DEFB106; MGC118938; MGC118939; MGC118940; MGC118941; MGC133011; MGC133012;
Gene ID 245909
mRNA Refseq NM_152251
Protein Refseq NP_689464
UniProt ID Q8N104

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB106A Products

Required fields are marked with *

My Review for All DEFB106A Products

Required fields are marked with *

0
cart-icon