Recombinant Human DEGS2 Protein, GST-tagged

Cat.No. : DEGS2-5212H
Product Overview : Human DEGS2 full-length ORF ( NP_996801.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a bifunctional enzyme that is involved in the biosynthesis of phytosphingolipids in human skin and in other phytosphingolipid-containing tissues. This enzyme can act as a sphingolipid delta(4)-desaturase, and also as a sphingolipid C4-hydroxylase. [provided by RefSeq, Oct 2008]
Molecular Mass : 63.6 kDa
AA Sequence : MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLTCWLVRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPYAASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLAKDGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEGS2 delta 4-desaturase, sphingolipid 2 [ Homo sapiens (human) ]
Official Symbol DEGS2
Synonyms DEGS2; delta 4-desaturase, sphingolipid 2; DES2; FADS8; C14orf66; sphingolipid delta(4)-desaturase/C4-monooxygenase DES2; degenerative spermatocyte homolog 2, lipid desaturase; dihydroceramide desaturase 2; sphingolipid 4-desaturase; sphingolipid C4-hydroxylase/delta 4-desaturase; sphingolipid C4-monooxygenase; sphingolipid delta 4 desaturase/C-4 hydroxylase; sphingolipid delta(4)-desaturase 2; sphingolipid delta(4)-desaturase/C4-hydroxylase DES2; EC 1.14.18.5; EC 1.14.19.17
Gene ID 123099
mRNA Refseq NM_206918
Protein Refseq NP_996801
MIM 610862
UniProt ID Q6QHC5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEGS2 Products

Required fields are marked with *

My Review for All DEGS2 Products

Required fields are marked with *

0
cart-icon