Recombinant Human DENND4A protein, GST-tagged

Cat.No. : DENND4A-301174H
Product Overview : Recombinant Human DENND4A (1478-1634 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Thr1478-Thr1634
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
AA Sequence : TTCPFCGNIFLPFLNIEIRDLRRPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVT
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name DENND4A DENN/MADD domain containing 4A [ Homo sapiens ]
Official Symbol DENND4A
Synonyms DENND4A; DENN/MADD domain containing 4A; c myc promoter binding protein , MYCPBP; C-myc promoter-binding protein; IRLB; c-myc promoter binding protein; DENN domain-containing protein 4A; MYCPBP; FLJ33949; KIAA0476;
Gene ID 10260
mRNA Refseq NM_001144823
Protein Refseq NP_001138295
MIM 600382
UniProt ID Q7Z401

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DENND4A Products

Required fields are marked with *

My Review for All DENND4A Products

Required fields are marked with *

0
cart-icon
0
compare icon