Recombinant Human DENND4A protein, GST-tagged
Cat.No. : | DENND4A-301174H |
Product Overview : | Recombinant Human DENND4A (1478-1634 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Thr1478-Thr1634 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | TTCPFCGNIFLPFLNIEIRDLRRPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DENND4A DENN/MADD domain containing 4A [ Homo sapiens ] |
Official Symbol | DENND4A |
Synonyms | DENND4A; DENN/MADD domain containing 4A; c myc promoter binding protein , MYCPBP; C-myc promoter-binding protein; IRLB; c-myc promoter binding protein; DENN domain-containing protein 4A; MYCPBP; FLJ33949; KIAA0476; |
Gene ID | 10260 |
mRNA Refseq | NM_001144823 |
Protein Refseq | NP_001138295 |
MIM | 600382 |
UniProt ID | Q7Z401 |
◆ Recombinant Proteins | ||
DENND4A-301174H | Recombinant Human DENND4A protein, GST-tagged | +Inquiry |
DENND4A-5181Z | Recombinant Zebrafish DENND4A | +Inquiry |
DENND4A-5794H | Recombinant Human DENND4A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DENND4A Products
Required fields are marked with *
My Review for All DENND4A Products
Required fields are marked with *