Recombinant Human DENR protein, His-SUMO-tagged
| Cat.No. : | DENR-2816H |
| Product Overview : | Recombinant Human DENR protein(O43583)(2-198aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-198aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 38 kDa |
| AA Sequence : | AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DENR density-regulated protein [ Homo sapiens ] |
| Official Symbol | DENR |
| Synonyms | DENR; density-regulated protein; DRP; DRP1; SMAP 3; smooth muscle cell associated protein-3; smooth muscle cell-associated protein 3; SMAP-3; |
| Gene ID | 8562 |
| mRNA Refseq | NM_003677 |
| Protein Refseq | NP_003668 |
| MIM | 604550 |
| UniProt ID | O43583 |
| ◆ Recombinant Proteins | ||
| DENR-2816H | Recombinant Human DENR protein, His-SUMO-tagged | +Inquiry |
| DENR-4516M | Recombinant Mouse DENR Protein | +Inquiry |
| DENR-3643H | Recombinant Human DENR, His-tagged | +Inquiry |
| DENR-800Z | Recombinant Zebrafish DENR | +Inquiry |
| Denr-2526M | Recombinant Mouse Denr Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DENR-6975HCL | Recombinant Human DENR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DENR Products
Required fields are marked with *
My Review for All DENR Products
Required fields are marked with *
