Recombinant Human DEPDC1, GST-tagged
Cat.No. : | DEPDC1-120H |
Product Overview : | Recombinant Human DEPDC1 (93 a.a. - 186 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEP domain containing 1 is a protein that in humans is encoded by the DEPDC1 gene. |
Molecular Mass : | 36.08 kDa |
Sequence : | GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | DEPDC1 |
Gene Name | DEPDC1 DEP domain containing 1 [ Homo sapiens ] |
Synonyms | DEPDC1; DEP domain containing 1; DEP.8; SDP35; DEPDC1A; FLJ20354; DEPDC1-V2; DEP domain-containing protein 1A; 5830484J08Rik; cell cycle control protein SDP35 |
Gene ID | 55635 |
mRNA Refseq | NM_017779 |
Protein Refseq | NP_060249 |
MIM | 612002 |
UniProt ID | Q5TB30 |
Chromosome Location | 1p31.2 |
Function | GTPase activator activity; protein binding |
◆ Recombinant Proteins | ||
DEPDC1-120H | Recombinant Human DEPDC1, GST-tagged | +Inquiry |
DEPDC1-2160H | Recombinant Human DEPDC1 Protein (Phe138-Leu248), N-His tagged | +Inquiry |
DEPDC1-2141C | Recombinant Chicken DEPDC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEPDC1-6974HCL | Recombinant Human DEPDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEPDC1 Products
Required fields are marked with *
My Review for All DEPDC1 Products
Required fields are marked with *
0
Inquiry Basket