Recombinant Human DEPDC1, GST-tagged
| Cat.No. : | DEPDC1-120H |
| Product Overview : | Recombinant Human DEPDC1 (93 a.a. - 186 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DEP domain containing 1 is a protein that in humans is encoded by the DEPDC1 gene. |
| Molecular Mass : | 36.08 kDa |
| Sequence : | GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV |
| Purification : | Glutathione Sepharose 4 Fast Flow |
| Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | DEPDC1 |
| Gene Name | DEPDC1 DEP domain containing 1 [ Homo sapiens ] |
| Synonyms | DEPDC1; DEP domain containing 1; DEP.8; SDP35; DEPDC1A; FLJ20354; DEPDC1-V2; DEP domain-containing protein 1A; 5830484J08Rik; cell cycle control protein SDP35 |
| Gene ID | 55635 |
| mRNA Refseq | NM_017779 |
| Protein Refseq | NP_060249 |
| MIM | 612002 |
| UniProt ID | Q5TB30 |
| Chromosome Location | 1p31.2 |
| Function | GTPase activator activity; protein binding |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEPDC1 Products
Required fields are marked with *
My Review for All DEPDC1 Products
Required fields are marked with *



