Recombinant Human DEPDC1, GST-tagged

Cat.No. : DEPDC1-120H
Product Overview : Recombinant Human DEPDC1 (93 a.a. - 186 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEP domain containing 1 is a protein that in humans is encoded by the DEPDC1 gene.
Molecular Mass : 36.08 kDa
Sequence : GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
Purification : Glutathione Sepharose 4 Fast Flow
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : DEPDC1
Gene Name DEPDC1 DEP domain containing 1 [ Homo sapiens ]
Synonyms DEPDC1; DEP domain containing 1; DEP.8; SDP35; DEPDC1A; FLJ20354; DEPDC1-V2; DEP domain-containing protein 1A; 5830484J08Rik; cell cycle control protein SDP35
Gene ID 55635
mRNA Refseq NM_017779
Protein Refseq NP_060249
MIM 612002
UniProt ID Q5TB30
Chromosome Location 1p31.2
Function GTPase activator activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEPDC1 Products

Required fields are marked with *

My Review for All DEPDC1 Products

Required fields are marked with *

0
cart-icon