Recombinant Human DEPDC1B Protein, GST-tagged
| Cat.No. : | DEPDC1B-2541H |
| Product Overview : | Human DEPDC1B full-length ORF ( AAH10904, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DEPDC1B (DEP Domain Containing 1B) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and p75 NTR receptor-mediated signalling. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is DEPDC1. |
| Molecular Mass : | 46.31 kDa |
| AA Sequence : | MPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQVKYPGADMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DEPDC1B DEP domain containing 1B [ Homo sapiens ] |
| Official Symbol | DEPDC1B |
| Synonyms | DEPDC1B; DEP domain containing 1B; DEP domain-containing protein 1B; BRCC3; breast cancer cell 3; XTP1; HBxAg transactivated protein 1; HBV XAg-transactivated protein 8; HBV X-transactivated gene 8 protein; FLJ11252; |
| Gene ID | 55789 |
| mRNA Refseq | NM_001145208 |
| Protein Refseq | NP_001138680 |
| MIM | 616073 |
| UniProt ID | Q8WUY9 |
| ◆ Recombinant Proteins | ||
| DEPDC1B-2333M | Recombinant Mouse DEPDC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEPDC1B-461C | Recombinant Cynomolgus DEPDC1B Protein, His-tagged | +Inquiry |
| DEPDC1B-2541H | Recombinant Human DEPDC1B Protein, GST-tagged | +Inquiry |
| DEPDC1B-207C | Recombinant Cynomolgus Monkey DEPDC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| DEPDC1B-4518M | Recombinant Mouse DEPDC1B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DEPDC1B-223HCL | Recombinant Human DEPDC1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEPDC1B Products
Required fields are marked with *
My Review for All DEPDC1B Products
Required fields are marked with *
