Recombinant Human DEPDC1B Protein, GST-tagged
Cat.No. : | DEPDC1B-2541H |
Product Overview : | Human DEPDC1B full-length ORF ( AAH10904, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEPDC1B (DEP Domain Containing 1B) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and p75 NTR receptor-mediated signalling. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is DEPDC1. |
Molecular Mass : | 46.31 kDa |
AA Sequence : | MPPLCDGFGTRTLMVQTFSRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQVKYPGADMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKSYPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DEPDC1B DEP domain containing 1B [ Homo sapiens ] |
Official Symbol | DEPDC1B |
Synonyms | DEPDC1B; DEP domain containing 1B; DEP domain-containing protein 1B; BRCC3; breast cancer cell 3; XTP1; HBxAg transactivated protein 1; HBV XAg-transactivated protein 8; HBV X-transactivated gene 8 protein; FLJ11252; |
Gene ID | 55789 |
mRNA Refseq | NM_001145208 |
Protein Refseq | NP_001138680 |
MIM | 616073 |
UniProt ID | Q8WUY9 |
◆ Recombinant Proteins | ||
DEPDC1B-1068R | Recombinant Rhesus Macaque DEPDC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
DEPDC1B-207C | Recombinant Cynomolgus Monkey DEPDC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
DEPDC1B-1713C | Recombinant Chicken DEPDC1B | +Inquiry |
DEPDC1B-2541H | Recombinant Human DEPDC1B Protein, GST-tagged | +Inquiry |
DEPDC1B-2471HF | Recombinant Full Length Human DEPDC1B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEPDC1B-223HCL | Recombinant Human DEPDC1B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEPDC1B Products
Required fields are marked with *
My Review for All DEPDC1B Products
Required fields are marked with *
0
Inquiry Basket