Recombinant Human DERL1 Protein, GST-tagged

Cat.No. : DERL1-2546H
Product Overview : Human DERL1 full-length ORF ( NP_077271.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the derlin family. Members of this family participate in the ER-associated degradation response and retrotranslocate misfolded or unfolded proteins from the ER lumen to the cytosol for proteasomal degradation. This protein recognizes substrate in the ER and works in a complex to retrotranslocate it across the ER membrane into the cytosol. This protein may select cystic fibrosis transmembrane conductance regulator protein (CFTR) for degradation as well as unfolded proteins in Alzheimer's disease. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]
Molecular Mass : 55.2 kDa
AA Sequence : MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DERL1 Der1-like domain family, member 1 [ Homo sapiens ]
Official Symbol DERL1
Synonyms DERL1; Der1-like domain family, member 1; derlin-1; DER 1; DER1; derlin 1; FLJ13784; MGC3067; PRO2577; DERtrin-1; der1-like protein 1; degradation in endoplasmic reticulum protein 1; DER-1; FLJ42092;
Gene ID 79139
mRNA Refseq NM_001134671
Protein Refseq NP_001128143
MIM 608813
UniProt ID Q9BUN8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DERL1 Products

Required fields are marked with *

My Review for All DERL1 Products

Required fields are marked with *

0
cart-icon