Recombinant Human DERL2 protein, His-tagged
Cat.No. : | DERL2-11941H |
Product Overview : | Recombinant Human DERL2 protein(1-70 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-70 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DERL2 Der1-like domain family, member 2 [ Homo sapiens ] |
Official Symbol | DERL2 |
Synonyms | DERL2; Der1-like domain family, member 2; derlin-2; CGI 101; derlin 2; F LAN 1; F LANa; FLANa; DERtrin-2; carcinoma related; der1-like protein 2; degradation in endoplasmic reticulum protein 2; F-LANa; CGI-101; F-LAN-1; |
Gene ID | 51009 |
mRNA Refseq | NM_016041 |
Protein Refseq | NP_057125 |
MIM | 610304 |
UniProt ID | Q9GZP9 |
◆ Recombinant Proteins | ||
DERL2-3002Z | Recombinant Zebrafish DERL2 | +Inquiry |
DERL2-11941H | Recombinant Human DERL2 protein, His-tagged | +Inquiry |
RFL33857PF | Recombinant Full Length Pongo Abelii Derlin-2(Derl2) Protein, His-Tagged | +Inquiry |
RFL24828MF | Recombinant Full Length Mouse Derlin-2(Derl2) Protein, His-Tagged | +Inquiry |
DERL2-2389H | Recombinant Human DERL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DERL2-6970HCL | Recombinant Human DERL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DERL2 Products
Required fields are marked with *
My Review for All DERL2 Products
Required fields are marked with *