Recombinant Human DESI1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DESI1-6133H
• Product Overview: PPPDE2 MS Standard C13 and N15-labeled recombinant protein (NP_056519) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DESI1 (Desumoylating Isopeptidase 1) is a Protein Coding gene. Diseases associated with DESI1 include Parkinson Disease 7, Autosomal Recessive Early-Onset. Gene Ontology (GO) annotations related to this gene include identical protein binding and peptidase activity. An important paralog of this gene is DESI2.
• Molecular Mass: 18.3 kDa
• AA Sequence: MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DESI1 desumoylating isopeptidase 1 [ Homo sapiens (human) ]
• Official Symbol: DESI1
• Synonyms: DESI1; desumoylating isopeptidase 1; POST; DESI2; DeSI-1; PPPDE2; FAM152B; D15Wsu75e; DJ347H13.4; desumoylating isopeptidase 1; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; desumoylating isopeptidase 2; family with sequence similarity 152, member B; polyubiquitinated substrate transporter
• Gene ID: 27351
• mRNA Refseq: NM_015704
• Protein Refseq: NP_056519
• MIM: 614637
• UniProt ID: Q6ICB0