Recombinant Human DESI1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DESI1-6133H |
Product Overview : | PPPDE2 MS Standard C13 and N15-labeled recombinant protein (NP_056519) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DESI1 (Desumoylating Isopeptidase 1) is a Protein Coding gene. Diseases associated with DESI1 include Parkinson Disease 7, Autosomal Recessive Early-Onset. Gene Ontology (GO) annotations related to this gene include identical protein binding and peptidase activity. An important paralog of this gene is DESI2. |
Molecular Mass : | 18.3 kDa |
AA Sequence : | MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DESI1 desumoylating isopeptidase 1 [ Homo sapiens (human) ] |
Official Symbol | DESI1 |
Synonyms | DESI1; desumoylating isopeptidase 1; POST; DESI2; DeSI-1; PPPDE2; FAM152B; D15Wsu75e; DJ347H13.4; desumoylating isopeptidase 1; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; desumoylating isopeptidase 2; family with sequence similarity 152, member B; polyubiquitinated substrate transporter |
Gene ID | 27351 |
mRNA Refseq | NM_015704 |
Protein Refseq | NP_056519 |
MIM | 614637 |
UniProt ID | Q6ICB0 |
◆ Recombinant Proteins | ||
DESI1-1245H | Recombinant Human DESI1 | +Inquiry |
DESI1-4527M | Recombinant Mouse DESI1 Protein | +Inquiry |
DESI1-2793H | Recombinant Human DESI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DESI1-6133H | Recombinant Human DESI1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DESI1-3789HF | Recombinant Full Length Human DESI1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DESI1 Products
Required fields are marked with *
My Review for All DESI1 Products
Required fields are marked with *