Recombinant Human DET1 Protein, GST-tagged
| Cat.No. : | DET1-2551H |
| Product Overview : | Human DET1 full-length ORF (BAG51398.1, 1 a.a. - 561 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DET1 (De-Etiolated Homolog 1 (Arabidopsis)) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. |
| Molecular Mass : | 91.5 kDa |
| AA Sequence : | MVGQILKRDVIMDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPCFLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRLFERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESVTPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIHVFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLLVYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPSQASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQIQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPKTCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYVVNFHMRHCCT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DET1 de-etiolated homolog 1 (Arabidopsis) [ Homo sapiens ] |
| Official Symbol | DET1 |
| Synonyms | DET1; de-etiolated homolog 1 (Arabidopsis); DET1 homolog; FLJ10103; de-etiolated 1; de-etiolated-1 homolog; MGC126156; MGC126157; |
| Gene ID | 55070 |
| mRNA Refseq | NM_001144074 |
| Protein Refseq | NP_001137546 |
| MIM | 608727 |
| UniProt ID | Q7L5Y6 |
| ◆ Recombinant Proteins | ||
| DET1-2339M | Recombinant Mouse DET1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DET1-4529M | Recombinant Mouse DET1 Protein | +Inquiry |
| DET1-1072R | Recombinant Rhesus Macaque DET1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DET1-2477HF | Recombinant Full Length Human DET1 Protein, GST-tagged | +Inquiry |
| DET1-10069Z | Recombinant Zebrafish DET1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DET1 Products
Required fields are marked with *
My Review for All DET1 Products
Required fields are marked with *
