Recombinant Human DEXI Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DEXI-938H
• Product Overview: DEXI MS Standard C13 and N15-labeled recombinant protein (NP_054734) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DEXI (Dexi Homolog) is a Protein Coding gene. Diseases associated with DEXI include Angelman Syndrome.
• Molecular Mass: 10.4 kDa
• AA Sequence: MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DEXI Dexi homolog [ Homo sapiens (human) ]
• Official Symbol: DEXI
• Synonyms: DEXI; Dexi homolog; MYLE; dexamethasone-induced protein; dexamethasone-induced transcript
• Gene ID: 28955
• mRNA Refseq: NM_014015
• Protein Refseq: NP_054734
• MIM: 617901
• UniProt ID: O95424