Recombinant Human DFFB Protein(11-290aa), His-tagged
| Cat.No. : | QKI-11H | 
| Product Overview : | Recombinant Human DFFB Protein(11-290aa)(Q96PU8), fused with C-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 11-290aa | 
| Form : | 0.15 M Phosphate buffered saline. | 
| AA Sequence : | PKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEY | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| Gene Name | QKI QKI, KH domain containing, RNA binding [ Homo sapiens ] | 
| Official Symbol | QKI | 
| Synonyms | QKI; QKI, KH domain containing, RNA binding; quaking homolog, KH domain RNA binding (mouse); protein quaking; QK3; RNA binding protein HQK; quaking homolog, KH domain RNA binding; homolog of mouse quaking QKI (KH domain RNA binding protein); QK; Hqk; QK1; hqkI; DKFZp586I0923 | 
| Gene ID | 9444 | 
| mRNA Refseq | NM_006775 | 
| Protein Refseq | NP_006766 | 
| MIM | 609590 | 
| UniProt ID | Q96PU8 | 
| ◆ Recombinant Proteins | ||
| QKI-792H | Recombinant Human QKI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| QKI-5883C | Recombinant Chicken QKI | +Inquiry | 
| QKI-7322M | Recombinant Mouse QKI Protein, His (Fc)-Avi-tagged | +Inquiry | 
| QKI-11H | Recombinant Human DFFB Protein(11-290aa), His-tagged | +Inquiry | 
| QKI-1246H | Recombinant Human QKI Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| QKI-2640HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry | 
| QKI-2639HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry | 
| QKI-2638HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QKI Products
Required fields are marked with *
My Review for All QKI Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            