Recombinant Human DFFB Protein(11-290aa), His-tagged
Cat.No. : | QKI-11H |
Product Overview : | Recombinant Human DFFB Protein(11-290aa)(Q96PU8), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-290aa |
Form : | 0.15 M Phosphate buffered saline. |
AA Sequence : | PKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEY |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | QKI QKI, KH domain containing, RNA binding [ Homo sapiens ] |
Official Symbol | QKI |
Synonyms | QKI; QKI, KH domain containing, RNA binding; quaking homolog, KH domain RNA binding (mouse); protein quaking; QK3; RNA binding protein HQK; quaking homolog, KH domain RNA binding; homolog of mouse quaking QKI (KH domain RNA binding protein); QK; Hqk; QK1; hqkI; DKFZp586I0923 |
Gene ID | 9444 |
mRNA Refseq | NM_006775 |
Protein Refseq | NP_006766 |
MIM | 609590 |
UniProt ID | Q96PU8 |
◆ Recombinant Proteins | ||
QKI-7322M | Recombinant Mouse QKI Protein, His (Fc)-Avi-tagged | +Inquiry |
QKI-11H | Recombinant Human DFFB Protein(11-290aa), His-tagged | +Inquiry |
QKI-294H | Recombinant Human QKI, KH domain containing, RNA binding, His-tagged | +Inquiry |
Qk-5278M | Recombinant Mouse Qk Protein, Myc/DDK-tagged | +Inquiry |
QKI-2091H | Recombinant Human DFFB Protein(1-341aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
QKI-2638HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
QKI-2640HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
QKI-2639HCL | Recombinant Human QKI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QKI Products
Required fields are marked with *
My Review for All QKI Products
Required fields are marked with *
0
Inquiry Basket