Recombinant Human DGAT1 protein, His-tagged

Cat.No. : DGAT1-27H
Product Overview : Recombinant Human DGAT1 protein(200-300 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 200-300 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4, 17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
Gene Name DGAT1 diacylglycerol O-acyltransferase 1 [ Homo sapiens ]
Official Symbol DGAT1
Synonyms DGAT1; diacylglycerol O-acyltransferase 1; diacylglycerol O acyltransferase homolog 1 (mouse); ARGP1; DGAT; ACAT related gene product 1; ACAT-related gene product 1; diglyceride acyltransferase; diacylglycerol O-acyltransferase homolog 1; acyl coenzyme A:cholesterol acyltransferase related gene 1;
Gene ID 8694
mRNA Refseq NM_012079
Protein Refseq NP_036211
MIM 604900
UniProt ID O75907

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGAT1 Products

Required fields are marked with *

My Review for All DGAT1 Products

Required fields are marked with *

0
cart-icon