Recombinant Human DGCR6L Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DGCR6L-6260H
Product Overview : DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome.
Molecular Mass : 24.9 kDa
AA Sequence : MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DGCR6L DiGeorge syndrome critical region gene 6-like [ Homo sapiens (human) ]
Official Symbol DGCR6L
Synonyms DGCR6L; DiGeorge syndrome critical region gene 6-like; protein DGCR6L; FLJ10666; DiGeorge syndrome critical region gene 6 like; diGeorge syndrome critical region 6-like protein;
Gene ID 85359
mRNA Refseq NM_033257
Protein Refseq NP_150282
MIM 609459
UniProt ID Q9BY27

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGCR6L Products

Required fields are marked with *

My Review for All DGCR6L Products

Required fields are marked with *

0
cart-icon
0
compare icon