Recombinant Human DGCR6L Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DGCR6L-6260H |
Product Overview : | DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DGCR6L DiGeorge syndrome critical region gene 6-like [ Homo sapiens (human) ] |
Official Symbol | DGCR6L |
Synonyms | DGCR6L; DiGeorge syndrome critical region gene 6-like; protein DGCR6L; FLJ10666; DiGeorge syndrome critical region gene 6 like; diGeorge syndrome critical region 6-like protein; |
Gene ID | 85359 |
mRNA Refseq | NM_033257 |
Protein Refseq | NP_150282 |
MIM | 609459 |
UniProt ID | Q9BY27 |
◆ Recombinant Proteins | ||
DGCR6L-2566H | Recombinant Human DGCR6L Protein, GST-tagged | +Inquiry |
DGCR6L-6260H | Recombinant Human DGCR6L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DGCR6L-4872H | Recombinant Human DGCR6L protein, His-SUMO-tagged | +Inquiry |
DGCR6L-570H | Recombinant Human DiGeorge syndrome critical region gene 6, His-tagged | +Inquiry |
DGCR6L-2494HF | Recombinant Full Length Human DGCR6L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGCR6L-6963HCL | Recombinant Human DGCR6L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGCR6L Products
Required fields are marked with *
My Review for All DGCR6L Products
Required fields are marked with *