Recombinant Human DGKE Protein, GST-tagged
Cat.No. : | DGKE-2572H |
Product Overview : | Human DGKE full-length ORF ( AAH22297, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.21 kDa |
AA Sequence : | MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DGKE diacylglycerol kinase, epsilon 64kDa [ Homo sapiens ] |
Official Symbol | DGKE |
Synonyms | DGKE; diacylglycerol kinase, epsilon 64kDa; diacylglycerol kinase, epsilon (64kD); diacylglycerol kinase epsilon; DAGK6; DGK; DGK-epsilon; DAG kinase epsilon; diglyceride kinase epsilon; DAGK5; |
Gene ID | 8526 |
mRNA Refseq | NM_003647 |
Protein Refseq | NP_003638 |
MIM | 601440 |
UniProt ID | P52429 |
◆ Recombinant Proteins | ||
DGKE-2498HF | Recombinant Full Length Human DGKE Protein, GST-tagged | +Inquiry |
DGKE-2351M | Recombinant Mouse DGKE Protein, His (Fc)-Avi-tagged | +Inquiry |
DGKE-597H | Recombinant Human DGKE protein, His-tagged | +Inquiry |
DGKE-2247H | Recombinant Human DGKE Protein (Leu243-Gly502), N-His tagged | +Inquiry |
DGKE-4545M | Recombinant Mouse DGKE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKE-6957HCL | Recombinant Human DGKE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGKE Products
Required fields are marked with *
My Review for All DGKE Products
Required fields are marked with *
0
Inquiry Basket