Recombinant Human DGKE Protein, GST-tagged

Cat.No. : DGKE-2572H
Product Overview : Human DGKE full-length ORF ( AAH22297, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. [provided by RefSeq, Jul 2008]
Molecular Mass : 45.21 kDa
AA Sequence : MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DGKE diacylglycerol kinase, epsilon 64kDa [ Homo sapiens ]
Official Symbol DGKE
Synonyms DGKE; diacylglycerol kinase, epsilon 64kDa; diacylglycerol kinase, epsilon (64kD); diacylglycerol kinase epsilon; DAGK6; DGK; DGK-epsilon; DAG kinase epsilon; diglyceride kinase epsilon; DAGK5;
Gene ID 8526
mRNA Refseq NM_003647
Protein Refseq NP_003638
MIM 601440
UniProt ID P52429

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGKE Products

Required fields are marked with *

My Review for All DGKE Products

Required fields are marked with *

0
cart-icon
0
compare icon