Recombinant Human DGKE Protein, GST-tagged
| Cat.No. : | DGKE-2572H |
| Product Overview : | Human DGKE full-length ORF ( AAH22297, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 45.21 kDa |
| AA Sequence : | MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DGKE diacylglycerol kinase, epsilon 64kDa [ Homo sapiens ] |
| Official Symbol | DGKE |
| Synonyms | DGKE; diacylglycerol kinase, epsilon 64kDa; diacylglycerol kinase, epsilon (64kD); diacylglycerol kinase epsilon; DAGK6; DGK; DGK-epsilon; DAG kinase epsilon; diglyceride kinase epsilon; DAGK5; |
| Gene ID | 8526 |
| mRNA Refseq | NM_003647 |
| Protein Refseq | NP_003638 |
| MIM | 601440 |
| UniProt ID | P52429 |
| ◆ Recombinant Proteins | ||
| DGKE-2497HF | Recombinant Full Length Human DGKE Protein | +Inquiry |
| DGKE-2351M | Recombinant Mouse DGKE Protein, His (Fc)-Avi-tagged | +Inquiry |
| DGKE-597H | Recombinant Human DGKE protein, His-tagged | +Inquiry |
| DGKE-2572H | Recombinant Human DGKE Protein, GST-tagged | +Inquiry |
| DGKE-2498HF | Recombinant Full Length Human DGKE Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGKE-6957HCL | Recombinant Human DGKE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGKE Products
Required fields are marked with *
My Review for All DGKE Products
Required fields are marked with *
