Recombinant Human DGKZ, His-tagged
| Cat.No. : | DGKZ-26682TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 641-895 of Human DGKZ with N terminal His tag; MWt 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 641-895 a.a. |
| Description : | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified. |
| Conjugation : | HIS |
| Tissue specificity : | Highest levels in brain, and substantial levels in skeletal muscle, heart, and pancreas. Isoform 1 is predominantly expressed in muscle. |
| Form : | Lyophilised:Reconstitute with 148 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSP KWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILD PELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPP QGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLL HHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTE LAAYLENRQHYQMIQREDQETAV |
| Sequence Similarities : | Belongs to the eukaryotic diacylglycerol kinase family.Contains 2 ANK repeats.Contains 1 DAGKc domain.Contains 2 phorbol-ester/DAG-type zinc fingers. |
| Gene Name | DGKZ diacylglycerol kinase, zeta [ Homo sapiens ] |
| Official Symbol | DGKZ |
| Synonyms | DGKZ; diacylglycerol kinase, zeta; diacylglycerol kinase, zeta 104kDa; diacylglycerol kinase zeta; DAGK5; DAGK6; DGK ZETA; hDGKzeta; |
| Gene ID | 8525 |
| mRNA Refseq | NM_001199267 |
| Protein Refseq | NP_001186196 |
| MIM | 601441 |
| Uniprot ID | Q13574 |
| Chromosome Location | 11p11.2 |
| Pathway | Effects of PIP2 hydrolysis, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; |
| Function | ATP binding; diacylglycerol kinase activity; diacylglycerol kinase activity; enzyme inhibitor activity; lipid kinase activity; |
| ◆ Recombinant Proteins | ||
| DGKZ-3295H | Recombinant Human DGKZ Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DGKZ-1515R | Recombinant Rat DGKZ Protein, His (Fc)-Avi-tagged | +Inquiry |
| DGKZ-6744H | Recombinant Human DGKZ protein, His-tagged | +Inquiry |
| Dgkz-1364M | Recombinant Mouse Dgkz protein, His & T7-tagged | +Inquiry |
| DGKZ-2856C | Recombinant Chicken DGKZ | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGKZ-6953HCL | Recombinant Human DGKZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGKZ Products
Required fields are marked with *
My Review for All DGKZ Products
Required fields are marked with *



