Recombinant Human DGKZ, His-tagged

Cat.No. : DGKZ-26682TH
Product Overview : Recombinant fragment, corresponding to amino acids 641-895 of Human DGKZ with N terminal His tag; MWt 35kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 641-895 a.a.
Description : The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and multiple transcript variants encoding distinct isoforms have been identified.
Conjugation : HIS
Tissue specificity : Highest levels in brain, and substantial levels in skeletal muscle, heart, and pancreas. Isoform 1 is predominantly expressed in muscle.
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKLSP KWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILD PELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPP QGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLL HHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDTPRQRAEKAQDTE LAAYLENRQHYQMIQREDQETAV
Sequence Similarities : Belongs to the eukaryotic diacylglycerol kinase family.Contains 2 ANK repeats.Contains 1 DAGKc domain.Contains 2 phorbol-ester/DAG-type zinc fingers.
Gene Name DGKZ diacylglycerol kinase, zeta [ Homo sapiens ]
Official Symbol DGKZ
Synonyms DGKZ; diacylglycerol kinase, zeta; diacylglycerol kinase, zeta 104kDa; diacylglycerol kinase zeta; DAGK5; DAGK6; DGK ZETA; hDGKzeta;
Gene ID 8525
mRNA Refseq NM_001199267
Protein Refseq NP_001186196
MIM 601441
Uniprot ID Q13574
Chromosome Location 11p11.2
Pathway Effects of PIP2 hydrolysis, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem;
Function ATP binding; diacylglycerol kinase activity; diacylglycerol kinase activity; enzyme inhibitor activity; lipid kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DGKZ Products

Required fields are marked with *

My Review for All DGKZ Products

Required fields are marked with *

0
cart-icon