Recombinant Human DHH protein, His-GST&Myc-tagged

• Cat.No.: DHH-332H
• Product Overview: Recombinant Human DHH protein(O43323)(51-158aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 51-158aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK

Gene Information

• Gene Name: DHH desert hedgehog [ Homo sapiens ]
• Official Symbol: DHH
• Synonyms: DHH; desert hedgehog; desert hedgehog (Drosophila) homolog; desert hedgehog protein; HHG 3; MGC35145; mutant desert hedgehog; desert hedgehog homolog; GDXYM; HHG-3; SRXY7
• Gene ID: 50846
• mRNA Refseq: NM_021044
• Protein Refseq: NP_066382
• MIM: 605423
• UniProt ID: O43323