Recombinant Human DHH protein, His-GST&Myc-tagged
Cat.No. : | DHH-332H |
Product Overview : | Recombinant Human DHH protein(O43323)(51-158aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 51-158aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK |
Gene Name | DHH desert hedgehog [ Homo sapiens ] |
Official Symbol | DHH |
Synonyms | DHH; desert hedgehog; desert hedgehog (Drosophila) homolog; desert hedgehog protein; HHG 3; MGC35145; mutant desert hedgehog; desert hedgehog homolog; GDXYM; HHG-3; SRXY7; |
Gene ID | 50846 |
mRNA Refseq | NM_021044 |
Protein Refseq | NP_066382 |
MIM | 605423 |
UniProt ID | O43323 |
◆ Recombinant Proteins | ||
DHH-332H | Recombinant Human DHH protein, His-GST&Myc-tagged | +Inquiry |
DHH-267H | Recombinant Human desert hedgehog, His-tagged | +Inquiry |
DHH-2531HF | Recombinant Full Length Human DHH Protein, GST-tagged | +Inquiry |
Dhh-393M | Recombinant Mouse Dhh protein | +Inquiry |
DHH-2122H | Recombinant Human DHH Protein (Leu241-Tyr383), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHH-469HCL | Recombinant Human DHH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHH Products
Required fields are marked with *
My Review for All DHH Products
Required fields are marked with *