Recombinant Human DHRS7C protein, His-tagged
Cat.No. : | DHRS7C-3821H |
Product Overview : | Recombinant Human DHRS7C protein(206-308 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 206-308 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VEEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DHRS7C dehydrogenase/reductase (SDR family) member 7C [ Homo sapiens ] |
Official Symbol | DHRS7C |
Synonyms | DHRS7C; dehydrogenase/reductase (SDR family) member 7C; dehydrogenase/reductase SDR family member 7C; SDR32C2; short chain dehydrogenase/reductase family 32C; member 2; short chain dehydrogenase/reductase family 32C, member 2; |
Gene ID | 201140 |
mRNA Refseq | NM_001105571 |
Protein Refseq | NP_001099041 |
UniProt ID | A6NNS2 |
◆ Recombinant Proteins | ||
DHRS7C-2797H | Recombinant Human DHRS7C Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRS7C-5279C | Recombinant Chicken DHRS7C | +Inquiry |
DHRS7C-4568M | Recombinant Mouse DHRS7C Protein | +Inquiry |
DHRS7C-2361M | Recombinant Mouse DHRS7C Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRS7C-3821H | Recombinant Human DHRS7C protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRS7C Products
Required fields are marked with *
My Review for All DHRS7C Products
Required fields are marked with *