Recombinant Human DHTKD1 protein, His-tagged
Cat.No. : | DHTKD1-3030H |
Product Overview : | Recombinant Human DHTKD1 protein(32 - 197 aa), fused to His tag, was expressed in E. coli. |
Availability | June 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 32 - 197 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DHTKD1 dehydrogenase E1 and transketolase domain containing 1 [ Homo sapiens ] |
Official Symbol | DHTKD1 |
Synonyms | DHTKD1; dehydrogenase E1 and transketolase domain containing 1; probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial; dehydrogenase E1 and transketolase domain-containing protein 1; MGC3090; KIAA1630; DKFZp762M115; |
Gene ID | 55526 |
mRNA Refseq | NM_018706 |
Protein Refseq | NP_061176 |
◆ Recombinant Proteins | ||
DHTKD1-2550HF | Recombinant Full Length Human DHTKD1 Protein, GST-tagged | +Inquiry |
DHTKD1-3030H | Recombinant Human DHTKD1 protein, His-tagged | +Inquiry |
DHTKD1-2362M | Recombinant Mouse DHTKD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHTKD1-1864R | Recombinant Rat DHTKD1 Protein | +Inquiry |
DHTKD1-4570M | Recombinant Mouse DHTKD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHTKD1-475HCL | Recombinant Human DHTKD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHTKD1 Products
Required fields are marked with *
My Review for All DHTKD1 Products
Required fields are marked with *
0
Inquiry Basket