Recombinant Human DHX15 Protein, GST-tagged

• Cat.No.: DHX15-2606H
• Product Overview: Human DHX15 full-length ORF (1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. [provided by RefSeq, Jul 2008]
• Molecular Mass: 50.1 kDa
• AA Sequence: MLWVNLLSGLFSLFFITIFLIREHSCVGDSWCLLFSPPSAFLDHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHX15 DEAH (Asp-Glu-Ala-His) box polypeptide 15 [ Homo sapiens ]
• Official Symbol: DHX15
• Synonyms: DHX15; DEAH (Asp-Glu-Ala-His) box polypeptide 15; DDX15, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 15; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15; DBP1; HRH2; PRP43; PRPF43; PrPp43p; DEAD/H box-15; RNA helicase 2; DEAH box protein 15; ATP-dependent RNA helicase #46; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15; DDX15
• Gene ID: 1665
• mRNA Refseq: NM_001358
• Protein Refseq: NP_001349
• MIM: 603403
• UniProt ID: O43143