Recombinant Human DHX15 Protein, GST-tagged
Cat.No. : | DHX15-2606H |
Product Overview : | Human DHX15 full-length ORF (1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.1 kDa |
AA Sequence : | MLWVNLLSGLFSLFFITIFLIREHSCVGDSWCLLFSPPSAFLDHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHX15 DEAH (Asp-Glu-Ala-His) box polypeptide 15 [ Homo sapiens ] |
Official Symbol | DHX15 |
Synonyms | DHX15; DEAH (Asp-Glu-Ala-His) box polypeptide 15; DDX15, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 15; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15; DBP1; HRH2; PRP43; PRPF43; PrPp43p; DEAD/H box-15; RNA helicase 2; DEAH box protein 15; ATP-dependent RNA helicase #46; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15; DDX15; |
Gene ID | 1665 |
mRNA Refseq | NM_001358 |
Protein Refseq | NP_001349 |
MIM | 603403 |
UniProt ID | O43143 |
◆ Recombinant Proteins | ||
Dhx15-2554M | Recombinant Mouse Dhx15 Protein, Myc/DDK-tagged | +Inquiry |
DHX15-1086R | Recombinant Rhesus Macaque DHX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHX15-758H | Recombinant Human DHX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHX15-2300H | Recombinant Human DHX15 Protein, MYC/DDK-tagged | +Inquiry |
DHX15-1261R | Recombinant Rhesus monkey DHX15 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHX15-6933HCL | Recombinant Human DHX15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHX15 Products
Required fields are marked with *
My Review for All DHX15 Products
Required fields are marked with *