Recombinant Human DHX15 Protein, GST-tagged

Cat.No. : DHX15-2606H
Product Overview : Human DHX15 full-length ORF (1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing. [provided by RefSeq, Jul 2008]
Molecular Mass : 50.1 kDa
AA Sequence : MLWVNLLSGLFSLFFITIFLIREHSCVGDSWCLLFSPPSAFLDHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHX15 DEAH (Asp-Glu-Ala-His) box polypeptide 15 [ Homo sapiens ]
Official Symbol DHX15
Synonyms DHX15; DEAH (Asp-Glu-Ala-His) box polypeptide 15; DDX15, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 15; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15; DBP1; HRH2; PRP43; PRPF43; PrPp43p; DEAD/H box-15; RNA helicase 2; DEAH box protein 15; ATP-dependent RNA helicase #46; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 15; DDX15;
Gene ID 1665
mRNA Refseq NM_001358
Protein Refseq NP_001349
MIM 603403
UniProt ID O43143

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHX15 Products

Required fields are marked with *

My Review for All DHX15 Products

Required fields are marked with *

0
cart-icon