Recombinant Human DHX16 Protein, GST-tagged

Cat.No. : DHX16-2607H
Product Overview : Human DHX16 partial ORF ( NP_003578, 940 a.a. - 1041 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]
Molecular Mass : 36.96 kDa
AA Sequence : RKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREELG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHX16 DEAH (Asp-Glu-Ala-His) box polypeptide 16 [ Homo sapiens ]
Official Symbol DHX16
Synonyms DHX16; DEAH (Asp-Glu-Ala-His) box polypeptide 16; DDX16, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 16; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16; DBP2; Prp2; PRPF2; RNA helicase; DEAD/H box 16; DEAH-box protein 16; ATP-dependent RNA helicase #3; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16; PRP8; DDX16; PRO2014;
Gene ID 8449
mRNA Refseq NM_001164239
Protein Refseq NP_001157711
MIM 603405
UniProt ID O60231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHX16 Products

Required fields are marked with *

My Review for All DHX16 Products

Required fields are marked with *

0
cart-icon
0
compare icon