Recombinant Human DHX16 Protein, GST-tagged
Cat.No. : | DHX16-2607H |
Product Overview : | Human DHX16 partial ORF ( NP_003578, 940 a.a. - 1041 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009] |
Molecular Mass : | 36.96 kDa |
AA Sequence : | RKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHELVLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREELG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHX16 DEAH (Asp-Glu-Ala-His) box polypeptide 16 [ Homo sapiens ] |
Official Symbol | DHX16 |
Synonyms | DHX16; DEAH (Asp-Glu-Ala-His) box polypeptide 16; DDX16, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 16; putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16; DBP2; Prp2; PRPF2; RNA helicase; DEAD/H box 16; DEAH-box protein 16; ATP-dependent RNA helicase #3; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16; PRP8; DDX16; PRO2014; |
Gene ID | 8449 |
mRNA Refseq | NM_001164239 |
Protein Refseq | NP_001157711 |
MIM | 603405 |
UniProt ID | O60231 |
◆ Recombinant Proteins | ||
DHX16-2607H | Recombinant Human DHX16 Protein, GST-tagged | +Inquiry |
DHX16-1262R | Recombinant Rhesus monkey DHX16 Protein, His-tagged | +Inquiry |
DHX16-1087R | Recombinant Rhesus Macaque DHX16 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dhx16-2555M | Recombinant Mouse Dhx16 Protein, Myc/DDK-tagged | +Inquiry |
DHX16-10382Z | Recombinant Zebrafish DHX16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHX16-476HCL | Recombinant Human DHX16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHX16 Products
Required fields are marked with *
My Review for All DHX16 Products
Required fields are marked with *