Recombinant Human DIO2 protein, GST-tagged
Cat.No. : | DIO2-3650H |
Product Overview : | Recombinant Human DIO2 protein(171-273 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 171-273 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DIO2 deiodinase, iodothyronine, type II [ Homo sapiens ] |
Official Symbol | DIO2 |
Synonyms | DIO2; deiodinase, iodothyronine, type II; type II iodothyronine deiodinase; SelY; thyroxine deiodinase; type II; TXDI2; type 2 DI; type-II 5deiodinase; type-II 5-deiodinase; thyroxine deiodinase, type II; type 2 iodothyronine deiodinase; D2; 5DII; DIOII; |
Gene ID | 1734 |
mRNA Refseq | NM_000793 |
Protein Refseq | NP_000784 |
MIM | 601413 |
UniProt ID | Q92813 |
◆ Recombinant Proteins | ||
Dio2-1340M | Recombinant Mouse Dio2 Protein, His-tagged | +Inquiry |
DIO2-1527R | Recombinant Rat DIO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30280HF | Recombinant Full Length Human Type Ii Iodothyronine Deiodinase(Dio2) Protein, His-Tagged | +Inquiry |
DIO2-1869R | Recombinant Rat DIO2 Protein | +Inquiry |
DIO2-5690C | Recombinant Chicken DIO2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIO2 Products
Required fields are marked with *
My Review for All DIO2 Products
Required fields are marked with *
0
Inquiry Basket