Recombinant Human DIRAS1, His-tagged
Cat.No. : | DIRAS1-28349TH |
Product Overview : | Recombinant full length Human DIRAS1 with an N terminal His tag; 215 amino acids with tag, Predicted MWt 24.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 195 amino acids |
Description : | DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases. |
Conjugation : | HIS |
Molecular Weight : | 24.100kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKC |
Gene Name | DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ] |
Official Symbol | DIRAS1 |
Synonyms | DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; |
Gene ID | 148252 |
mRNA Refseq | NM_145173 |
Protein Refseq | NP_660156 |
MIM | 607862 |
Uniprot ID | O95057 |
Chromosome Location | 19p13.3 |
Function | GTP binding; GTPase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
DIRAS1-2570HF | Recombinant Full Length Human DIRAS1 Protein, GST-tagged | +Inquiry |
DIRAS1-2634H | Recombinant Human DIRAS1 Protein, GST-tagged | +Inquiry |
DIRAS1-4599M | Recombinant Mouse DIRAS1 Protein | +Inquiry |
DIRAS1-11999H | Recombinant Human DIRAS1 protein, GST-tagged | +Inquiry |
DIRAS1-28349TH | Recombinant Human DIRAS1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIRAS1-6922HCL | Recombinant Human DIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIRAS1 Products
Required fields are marked with *
My Review for All DIRAS1 Products
Required fields are marked with *
0
Inquiry Basket