Recombinant Human DIRAS1, His-tagged
| Cat.No. : | DIRAS1-28349TH |
| Product Overview : | Recombinant full length Human DIRAS1 with an N terminal His tag; 215 amino acids with tag, Predicted MWt 24.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 195 amino acids |
| Description : | DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases. |
| Conjugation : | HIS |
| Molecular Weight : | 24.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKC |
| Gene Name | DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ] |
| Official Symbol | DIRAS1 |
| Synonyms | DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; |
| Gene ID | 148252 |
| mRNA Refseq | NM_145173 |
| Protein Refseq | NP_660156 |
| MIM | 607862 |
| Uniprot ID | O95057 |
| Chromosome Location | 19p13.3 |
| Function | GTP binding; GTPase activity; nucleotide binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS1 Products
Required fields are marked with *
My Review for All DIRAS1 Products
Required fields are marked with *
