Recombinant Human DIRAS1 Protein, GST-tagged
| Cat.No. : | DIRAS1-2634H |
| Product Overview : | Human DIRAS1 full-length ORF ( NP_660156.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004] |
| Molecular Mass : | 48.7 kDa |
| AA Sequence : | MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ] |
| Official Symbol | DIRAS1 |
| Synonyms | DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681; |
| Gene ID | 148252 |
| mRNA Refseq | NM_145173 |
| Protein Refseq | NP_660156 |
| MIM | 607862 |
| UniProt ID | O95057 |
| ◆ Recombinant Proteins | ||
| Diras1-2566M | Recombinant Mouse Diras1 Protein, Myc/DDK-tagged | +Inquiry |
| DIRAS1-11999H | Recombinant Human DIRAS1 protein, GST-tagged | +Inquiry |
| DIRAS1-1092R | Recombinant Rhesus Macaque DIRAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DIRAS1-1267R | Recombinant Rhesus monkey DIRAS1 Protein, His-tagged | +Inquiry |
| DIRAS1-2817H | Recombinant Human DIRAS1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DIRAS1-6922HCL | Recombinant Human DIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS1 Products
Required fields are marked with *
My Review for All DIRAS1 Products
Required fields are marked with *
