Recombinant Human DIRAS1 Protein, GST-tagged

Cat.No. : DIRAS1-2634H
Product Overview : Human DIRAS1 full-length ORF ( NP_660156.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004]
Molecular Mass : 48.7 kDa
AA Sequence : MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ]
Official Symbol DIRAS1
Synonyms DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681;
Gene ID 148252
mRNA Refseq NM_145173
Protein Refseq NP_660156
MIM 607862
UniProt ID O95057

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DIRAS1 Products

Required fields are marked with *

My Review for All DIRAS1 Products

Required fields are marked with *

0
cart-icon