Recombinant Human DIRAS2 protein, His-tagged

• Cat.No.: DIRAS2-12000H
• Product Overview: Recombinant Human DIRAS2 protein(1-199 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-199 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: DIRAS2 DIRAS family, GTP-binding RAS-like 2 [ Homo sapiens ]
• Official Symbol: DIRAS2
• Synonyms: DIRAS2; DIRAS family, GTP-binding RAS-like 2; GTP-binding protein Di-Ras2; Di Ras2; DKFZp761C07121; distinct subgroup of the Ras family member 2; Di-Ras2
• Gene ID: 54769
• mRNA Refseq: NM_017594
• Protein Refseq: NP_060064
• MIM: 607863
• UniProt ID: Q96HU8