Recombinant Human DIRAS3 protein, His-tagged
Cat.No. : | DIRAS3-6778H |
Product Overview : | Recombinant Human DIRAS3 protein(90-225 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 90-225 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | TDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDK |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ] |
Official Symbol | DIRAS3 |
Synonyms | DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; rho-related GTP-binding protein RhoI; distinct subgroup of the Ras family member 3; ARHI; |
mRNA Refseq | NM_004675 |
Protein Refseq | NP_004666 |
MIM | 605193 |
UniProt ID | O95661 |
Gene ID | 9077 |
◆ Recombinant Proteins | ||
DIRAS3-1269R | Recombinant Rhesus monkey DIRAS3 Protein, His-tagged | +Inquiry |
DIRAS3-2819H | Recombinant Human DIRAS3 protein, GST-tagged | +Inquiry |
DIRAS3-292HFL | Active Recombinant Full Length Human DIRAS3 Protein, C-Flag-tagged | +Inquiry |
DIRAS3-4624H | Recombinant Human DIRAS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DIRAS3-2638H | Recombinant Human DIRAS3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIRAS3-779HCL | Recombinant Human DIRAS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIRAS3 Products
Required fields are marked with *
My Review for All DIRAS3 Products
Required fields are marked with *