Recombinant Human DIS3L protein, His-tagged
Cat.No. : | DIS3L-3724H |
Product Overview : | Recombinant Human DIS3L protein(727-971 aa), fused to His tag, was expressed in E. coli. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 727-971 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGAAYLKNKDGLVISCGPDSCSEWKPGSLQRFQNKITSTTTDGESVTFHLFDHVTVRISIQASRCHSDTIRLEIISNKPYKIPNTELIHQSSPLLKSELVKEVTKSVEEAQLAQEVKVNIIQEEYQEYRQTKGRSLYTLLEEIRDLALLDVSNNYGI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DIS3L DIS3 mitotic control homolog (S. cerevisiae)-like [ Homo sapiens ] |
Official Symbol | DIS3L |
Synonyms | DIS3L; DIS3 mitotic control homolog (S. cerevisiae)-like; DIS3-like exonuclease 1; FLJ38088; KIAA1955; MGC4562; DIS3L1; |
Gene ID | 115752 |
mRNA Refseq | NM_001143688 |
Protein Refseq | NP_001137160 |
MIM | 614183 |
UniProt ID | Q8TF46 |
◆ Recombinant Proteins | ||
DIS3L-2640H | Recombinant Human DIS3L Protein, GST-tagged | +Inquiry |
Dis3l-2569M | Recombinant Mouse Dis3l Protein, Myc/DDK-tagged | +Inquiry |
DIS3L-3724H | Recombinant Human DIS3L protein, His-tagged | +Inquiry |
DIS3L-5927H | Recombinant Human DIS3L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DIS3L-2575HF | Recombinant Full Length Human DIS3L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIS3L-1104HCL | Recombinant Human DIS3L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIS3L Products
Required fields are marked with *
My Review for All DIS3L Products
Required fields are marked with *