Recombinant Human DIXDC1, His-tagged
Cat.No. : | DIXDC1-27609TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 85-258 of Human DIXDC1 with N terminal His tag; 174 amino acids, 20kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 85-258 a.a. |
Description : | DIXDC1 belongs to the DIXDC1 family and contains 1 CH (calponin homology) domain and 1 DIX domain.The coiled coil domain mediates interaction with MAP3K4 and inhibition of AXIN1 mediated JNK activation through MAP3K4.The DIX domain mediates interaction with AXIN1 and inhibition of AXIN1 mediated JNK activation through MAP3K1. Probably also mediates interaction with DVL2.Functions as a positive effector of the Wnt signaling pathway. Regulates JNK activation by AXIN1 and DVL2. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 141 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVLALAA HFKPGSSRTVNQGRDSRAPLQSHRPHCATAVAQGAAAA LADVCHDMSRSGRDVFRYRQRNSSMDEEIENPYWSVRA LVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE KADFVIIPAEGIENRTEG |
Gene Name | DIXDC1 DIX domain containing 1 [ Homo sapiens ] |
Official Symbol | DIXDC1 |
Synonyms | DIXDC1; DIX domain containing 1; dixin; KIAA1735; |
Gene ID | 85458 |
mRNA Refseq | NM_001037954 |
Protein Refseq | NP_001033043 |
MIM | 610493 |
Uniprot ID | Q155Q3 |
Chromosome Location | 11q23.1 |
Function | actin binding; gamma-tubulin binding; mitogen-activated protein kinase kinase kinase binding; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
DIXDC1-2642H | Recombinant Human DIXDC1 Protein, GST-tagged | +Inquiry |
DIXDC1-1532R | Recombinant Rat DIXDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIXDC1-1874R | Recombinant Rat DIXDC1 Protein | +Inquiry |
DIXDC1-2580HF | Recombinant Full Length Human DIXDC1 Protein, GST-tagged | +Inquiry |
Dixdc1-1838M | Recombinant Mouse Dixdc1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIXDC1-6917HCL | Recombinant Human DIXDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DIXDC1 Products
Required fields are marked with *
My Review for All DIXDC1 Products
Required fields are marked with *