Recombinant Human DKK1 protein(32-266 aa), N-His-MBP-His-tagged

• Cat.No.: DKK1-2491H
• Product Overview: Recombinant Human DKK1 protein(O94907)(32-266 aa), fused with N-terminal His and MBP and His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&MBP
• Protein Length: 32-266 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Gene Information

• Gene Name: DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: DKK1
• Synonyms: DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1
• Gene ID: 22943
• mRNA Refseq: NM_012242
• Protein Refseq: NP_036374
• MIM: 605189
• UniProt ID: O94907