Recombinant Human DKK1 protein(32-266 aa), N-His-MBP-His-tagged
Cat.No. : | DKK1-2491H |
Product Overview : | Recombinant Human DKK1 protein(O94907)(32-266 aa), fused with N-terminal His and MBP and His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 32-266 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
Gene Name | DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DKK1 |
Synonyms | DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1; |
Gene ID | 22943 |
mRNA Refseq | NM_012242 |
Protein Refseq | NP_036374 |
MIM | 605189 |
UniProt ID | O94907 |
◆ Recombinant Proteins | ||
DKK1-386H | Active Recombinant Human DKK1, HIgG1 Fc-tagged | +Inquiry |
Dkk1-1752M | Recombinant Mouse Dkk1 protein, His & GST-tagged | +Inquiry |
DKK1-2491H | Recombinant Human DKK1 protein(32-266 aa), N-His-MBP-His-tagged | +Inquiry |
DKK1-023H | Active Recombinant Human DKK1 protein, His-tagged | +Inquiry |
DKK1-32H | Recombinant Human DKK1 protein(Met2-His266), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK1 Products
Required fields are marked with *
My Review for All DKK1 Products
Required fields are marked with *