Recombinant Human DKK1 protein(32-266 aa), N-SUMO & C-His-tagged
| Cat.No. : | DKK1-2490H |
| Product Overview : | Recombinant Human DKK1 protein(O94907)(32-266 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 32-266 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
| Gene Name | DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ] |
| Official Symbol | DKK1 |
| Synonyms | DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1; |
| Gene ID | 22943 |
| mRNA Refseq | NM_012242 |
| Protein Refseq | NP_036374 |
| MIM | 605189 |
| UniProt ID | O94907 |
| ◆ Recombinant Proteins | ||
| DKK1-276H | Active Recombinant Human DKK1 protein | +Inquiry |
| DKK1-164H | Active Recombinant Human DKK1 Protein, Biotinylated | +Inquiry |
| DKK1-894H | Recombinant Human DKK1 Protein, His-tagged | +Inquiry |
| DKK1-1649H | Recombinant Human DKK1 protein, hFc-Avi-tagged, Biotinylated | +Inquiry |
| DKK1-1965R | Recombinant Rhesus DKK1 protein, mFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
| DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK1 Products
Required fields are marked with *
My Review for All DKK1 Products
Required fields are marked with *
