Recombinant Human DKK2 Protein, GST-tagged

Cat.No. : DKK2-2666H
Product Overview : Human DKK2 full-length ORF (BAG35574.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist or antagonist of Wnt/beta-catenin signaling, depending on the cellular context and the presence of the co-factor kremen 2. Activity of this protein is also modulated by binding to the Wnt co-receptor LDL-receptor related protein 6 (LRP6). [provided by RefSeq, Jul 2008]
Molecular Mass : 54.89 kDa
AA Sequence : MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DKK2 dickkopf 2 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol DKK2
Synonyms DKK2; dickkopf 2 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 2; dickkopf-related protein 2; hDkk-2; dickkopf-2; dickkopf homolog 2; dickkopf related protein-2; DKK-2;
Gene ID 27123
mRNA Refseq NM_014421
Protein Refseq NP_055236
MIM 605415
UniProt ID Q9UBU2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DKK2 Products

Required fields are marked with *

My Review for All DKK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon