Recombinant Human DKK2 Protein, His-tagged
Cat.No. : | DKK2-2665H |
Product Overview : | Human DKK2 (NP_055236, 34 a.a. - 259 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 34-259 a.a. |
Description : | This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist or antagonist of Wnt/beta-catenin signaling, depending on the cellular context and the presence of the co-factor kremen 2. Activity of this protein is also modulated by binding to the Wnt co-receptor LDL-receptor related protein 6 (LRP6). [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 27.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI |
Purity : | > 90% by SDS - PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | In 20mM Tris-HCl buffer, pH 8.0 (0.4M Urea, 10% glycerol). |
Gene Name | DKK2 dickkopf 2 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DKK2 |
Synonyms | DKK2; dickkopf 2 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 2; dickkopf-related protein 2; hDkk-2; dickkopf-2; dickkopf homolog 2; dickkopf related protein-2; DKK-2; |
Gene ID | 27123 |
mRNA Refseq | NM_014421 |
Protein Refseq | NP_055236 |
MIM | 605415 |
UniProt ID | Q9UBU2 |
◆ Recombinant Proteins | ||
DKK2-2390M | Recombinant Mouse DKK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dkk2-193M | Active Recombinant Mouse Dkk2 protein, His-tagged | +Inquiry |
DKK2-6254Z | Recombinant Zebrafish DKK2 | +Inquiry |
DKK2-1343H | Recombinant Human DKK2 Protein, His-tagged | +Inquiry |
DKK2-4811H | Recombinant Human DKK2 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK2-225HCL | Recombinant Human DKK2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK2 Products
Required fields are marked with *
My Review for All DKK2 Products
Required fields are marked with *