"DKK2" Related Products

Expand

Recombinant Human DKK2 Protein, His-tagged

Cat.No. : DKK2-2665H
Product Overview : Human DKK2 (NP_055236, 34 a.a. - 259 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Description : This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist or antagonist of Wnt/beta-catenin signaling, depending on the cellular context and the presence of the co-factor kremen 2. Activity of this protein is also modulated by binding to the Wnt co-receptor LDL-receptor related protein 6 (LRP6). [provided by RefSeq, Jul 2008]
Source : E. coli
Species : Human
Tag : His
Form : Liquid
Molecular Mass : 27.6 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
Purity : > 90% by SDS - PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In 20mM Tris-HCl buffer, pH 8.0 (0.4M Urea, 10% glycerol).
Quality Control Testing :

3 μg/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

Gene Name : DKK2 dickkopf 2 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol : DKK2
Synonyms : DKK2; dickkopf 2 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 2; dickkopf-related protein 2; hDkk-2; dickkopf-2; dickkopf homolog 2; dickkopf related protein-2; DKK-2;
Gene ID : 27123
mRNA Refseq : NM_014421
Protein Refseq : NP_055236
MIM : 605415
UniProt ID : Q9UBU2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.