Recombinant Human DKK3, His-tagged
Cat.No. : | DKK3-26024TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 33-350 of Human 350 aa isoform DKK3 with N terminal His tag, Predicted MWt 36 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 33-350 a.a. |
Description : | This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 135 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEM EAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIH VHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECI IDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCG DQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDR CPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPR EVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAA AAALLGGEEI |
Gene Name | DKK3 dickkopf 3 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DKK3 |
Synonyms | DKK3; dickkopf 3 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 3; dickkopf-related protein 3; regulated in glioma; REIC; RIG; |
Gene ID | 27122 |
mRNA Refseq | NM_001018057 |
Protein Refseq | NP_001018067 |
MIM | 605416 |
Uniprot ID | Q9UBP4 |
Chromosome Location | 11p15.3 |
◆ Recombinant Proteins | ||
DKK3-1274R | Recombinant Rhesus monkey DKK3 Protein, His-tagged | +Inquiry |
DKK3-6682C | Recombinant Chicken DKK3 | +Inquiry |
DKK3-070H | Recombinant Human DKK3 Protein, Pro23-Ile350, C-His-Avi tagged, Biotinylated | +Inquiry |
DKK3-2533H | Recombinant Human DKK3 protein, His-tagged | +Inquiry |
Dkk3-198M | Recombinant Mouse Dkk3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK3-2672MCL | Recombinant Mouse DKK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK3 Products
Required fields are marked with *
My Review for All DKK3 Products
Required fields are marked with *