"DKK4" Related Products

Expand
Expand

Recombinant Human DKK4 Protein, GST-tagged

Cat.No. : DKK4-2668H
Product Overview : Human DKK4 full-length ORF ( NP_055235.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modulated by binding to the Wnt co-receptor and the co-factor kremen 2. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 51.3 kDa
AA Sequence : MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : DKK4 dickkopf homolog 4 (Xenopus laevis) [ Homo sapiens ]
Official Symbol : DKK4
Synonyms : DKK4; dickkopf homolog 4 (Xenopus laevis); dickkopf (Xenopus laevis) homolog 4; dickkopf-related protein 4; hDkk-4; dickkopf-4; DKK-4; MGC129562; MGC129563;
Gene ID : 27121
mRNA Refseq : NM_014420
Protein Refseq : NP_055235
MIM : 605417
UniProt ID : Q9UBT3

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.