Recombinant Human DLG1 Protein, GST-tagged
| Cat.No. : | DLG1-2675H |
| Product Overview : | Human DLG1 partial ORF ( NP_004078, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a multi-domain scaffolding protein that is required for normal development. This protein may have a role in septate junction formation, signal transduction, cell proliferation, synaptogenesis and lymphocyte activation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene, but the full-length nature of some of the variants is not known. [provided by RefSeq, Feb 2011] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DLG1 discs, large homolog 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | DLG1 |
| Synonyms | DLG1; discs, large homolog 1 (Drosophila); discs, large (Drosophila) homolog 1; disks large homolog 1; discs large homolog 1; dJ1061C18.1.1; DLGH1; hdlg; presynaptic protein SAP97; SAP 97; SAP97; synapse associated protein 97; synapse-associated protein 97; SAP-97; DKFZp761P0818; DKFZp781B0426; |
| Gene ID | 1739 |
| mRNA Refseq | NM_001098424 |
| Protein Refseq | NP_001091894 |
| MIM | 601014 |
| UniProt ID | Q12959 |
| ◆ Recombinant Proteins | ||
| DLG1-2396M | Recombinant Mouse DLG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DLG1-9933Z | Recombinant Zebrafish DLG1 | +Inquiry |
| DLG1-1878R | Recombinant Rat DLG1 Protein | +Inquiry |
| DLG1-1537R | Recombinant Rat DLG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DLG1-4619M | Recombinant Mouse DLG1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLG1 Products
Required fields are marked with *
My Review for All DLG1 Products
Required fields are marked with *
