Recombinant Human DLG3 protein, His-tagged
Cat.No. : | DLG3-3597H |
Product Overview : | Recombinant Human DLG3 protein(466-817 aa), fused to His tag, was expressed in E. coli. |
Availability | June 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 466-817 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DLG3 discs, large homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | DLG3 |
Synonyms | DLG3; discs, large homolog 3 (Drosophila); discs, large homolog 3 (neuroendocrine dlg, Drosophila); disks large homolog 3; KIAA1232; MRX90; NE Dlg; NEDLG; neuroendocrine dlg; SAP 102; SAP102; neuroendocrine-DLG; synapse-associated protein 102; MRX; XLMR; |
Gene ID | 1741 |
mRNA Refseq | NM_001166278 |
Protein Refseq | NP_001159750 |
MIM | 300189 |
UniProt ID | Q92796 |
◆ Recombinant Proteins | ||
DLG3-1880R | Recombinant Rat DLG3 Protein | +Inquiry |
DLG3-2340H | Recombinant Human DLG3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DLG3-3984HF | Recombinant Full Length Human DLG3 Protein, GST-tagged | +Inquiry |
DLG3-1277R | Recombinant Rhesus monkey DLG3 Protein, His-tagged | +Inquiry |
DLG3-1031R | Recombinant Rat DLG3 Protein (1-849 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLG3-6911HCL | Recombinant Human DLG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLG3 Products
Required fields are marked with *
My Review for All DLG3 Products
Required fields are marked with *
0
Inquiry Basket