Recombinant Human DLG3 protein, His-tagged

Cat.No. : DLG3-3597H
Product Overview : Recombinant Human DLG3 protein(466-817 aa), fused to His tag, was expressed in E. coli.
Availability August 09, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 466-817 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : RPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DLG3 discs, large homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol DLG3
Synonyms DLG3; discs, large homolog 3 (Drosophila); discs, large homolog 3 (neuroendocrine dlg, Drosophila); disks large homolog 3; KIAA1232; MRX90; NE Dlg; NEDLG; neuroendocrine dlg; SAP 102; SAP102; neuroendocrine-DLG; synapse-associated protein 102; MRX; XLMR;
Gene ID 1741
mRNA Refseq NM_001166278
Protein Refseq NP_001159750
MIM 300189
UniProt ID Q92796

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLG3 Products

Required fields are marked with *

My Review for All DLG3 Products

Required fields are marked with *

0
cart-icon
0
compare icon